PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG012442.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NAC
Protein Properties Length: 163aa    MW: 19031.5 Da    PI: 9.2865
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG012442.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.43.5e-50141401128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk... 95 
                  lppGfrF+Ptdeelv +yLk+k+ + +l++ +vi+ev+++k++Pw+Lp      e+e yfFs++++ky++g+r nr+ +sgyWkatg dk+++s+   
  CCG012442.1  14 LPPGFRFQPTDEELVFQYLKRKILSWPLPA-SVIHEVNVCKYDPWELPGD---MEQERYFFSNKETKYPNGNRVNRSSASGYWKATGLDKQIVSSswk 107
                  79****************************.99***************54...46799************************************9888 PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++ vg+kktLvfy+g+a +g++tdWvmheyrl
  CCG012442.1 108 NNHIVGMKKTLVFYRGKATHGSRTDWVMHEYRL 140
                  8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5310142IPR003441NAC domain
PROSITE profilePS5100551.35714155IPR003441NAC domain
PfamPF023653.2E-2615140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MEKLNFVRDG KIRLPPGFRF QPTDEELVFQ YLKRKILSWP LPASVIHEVN VCKYDPWELP  60
GDMEQERYFF SNKETKYPNG NRVNRSSASG YWKATGLDKQ IVSSSWKNNH IVGMKKTLVF  120
YRGKATHGSR TDWVMHEYRL VNVGEETTDC NFPQTENSAQ ASY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-441114114143NO APICAL MERISTEM PROTEIN
1ut4_B6e-441114114143NO APICAL MERISTEM PROTEIN
1ut7_A6e-441114114143NO APICAL MERISTEM PROTEIN
1ut7_B6e-441114114143NO APICAL MERISTEM PROTEIN
3swm_A8e-441114117146NAC domain-containing protein 19
3swm_B8e-441114117146NAC domain-containing protein 19
3swm_C8e-441114117146NAC domain-containing protein 19
3swm_D8e-441114117146NAC domain-containing protein 19
3swp_A8e-441114117146NAC domain-containing protein 19
3swp_B8e-441114117146NAC domain-containing protein 19
3swp_C8e-441114117146NAC domain-containing protein 19
3swp_D8e-441114117146NAC domain-containing protein 19
4dul_A6e-441114114143NAC domain-containing protein 19
4dul_B6e-441114114143NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7700130.0KP770013.1 Populus tomentosa trans-cinnamate 4-monooxygenase (Potri.015G102100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023926.11e-121PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY938e-72NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0F6V0521e-114A0A0F6V052_POPTO; Trans-cinnamate 4-monooxygenase
STRINGPOPTR_0012s10530.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.15e-73NAC domain containing protein 83